PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0256s0150.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 272aa    MW: 30503.9 Da    PI: 4.4621
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0256s0150.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1183.5e-372683562
                  zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                            a +cprC stntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rk ++++
  SapurV1A.0256s0150.1.p 26 APNCPRCASTNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKYRRAK 83
                            568**************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-291581IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.3412781IPR003851Zinc finger, Dof-type
PfamPF027011.1E-312781IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102965IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MYSATGQKMF LSPSMEKRWK SNAEVAPNCP RCASTNTKFC YYNNYSLSQP RYFCKGCRRY  60
WTKGGSLRNV PVGGGCRKYR RAKSSKVSQN DRAAVSVSYC RTNETTLACS SNNDSVAQQG  120
GANGSDIDLA VVFAKFLNQD LSYEPEFTGE ELVEEGCDQM VNISSSSTPS DHSLQNDAMM  180
ESLKRSDLIQ ESSLLEGKYQ GLVGEEQRLE EERIQELIES QEMNAFGLQN LLSDEIVQDA  240
LWSDDATLPN FPNWQPVVQL QDFDSFPWMI E*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1180185ESLKRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU2227461e-128CU222746.1 Populus EST from leave.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002307484.21e-165hypothetical protein POPTR_0005s21130g
TrEMBLB9H7P51e-165B9H7P5_POPTR; Uncharacterized protein
STRINGPOPTR_0005s21130.11e-165(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18173394
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.15e-44Dof family protein